PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID SapurV1A.0162s0220.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Salicaceae; Saliceae; Salix
Family NAC
Protein Properties Length: 380aa    MW: 43627.8 Da    PI: 6.0136
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
SapurV1A.0162s0220.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM167.25.6e-52151441129
                     NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvka...eekewyfFskrdkkyatgkrknratksgyWk 84 
                             +ppGfrFhPt+eel+++yL+kkv+ +k++l +vi++vd++k+ePwd+++++k     +++wyfFs++dkky++g+r+nrat++g+Wk
  SapurV1A.0162s0220.1.p  15 VPPGFRFHPTEEELLHYYLRKKVSFEKIDL-DVIRDVDLNKLEPWDIQERCKIgttPQNDWYFFSHKDKKYPSGTRTNRATAAGFWK 100
                             69****************************.9***************964444122455**************************** PP

                     NAM  85 atgkdkevlskkgelvglkktLvfykgrapkgektdWvmheyrle 129
                             atg+dk ++s +g+ +g++ktLvfykgrap+g+k+dW+mheyrle
  SapurV1A.0162s0220.1.p 101 ATGRDKVIYS-TGKRIGMRKTLVFYKGRAPHGQKSDWIMHEYRLE 144
                             **********.9999****************************85 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019414.58E-589173IPR003441NAC domain
PROSITE profilePS5100557.22615173IPR003441NAC domain
PfamPF023652.0E-2716143IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 380 aa     Download sequence    Send to blast
MTENMSISVN GQSQVPPGFR FHPTEEELLH YYLRKKVSFE KIDLDVIRDV DLNKLEPWDI  60
QERCKIGTTP QNDWYFFSHK DKKYPSGTRT NRATAAGFWK ATGRDKVIYS TGKRIGMRKT  120
LVFYKGRAPH GQKSDWIMHE YRLEDSTNDI NDSYVMEEAA QEEGWVVCRI FKKKYLNKTL  180
DKPLSSSPIT ADTRNQMLSS CDEGTIDQTL HYMERTCKEE NEADNSARYL IRPVDTAINY  240
VHHDRFMKLP SLESPNSISS QNCYQPMITD NEGSITNQTS YPLDPVPSLD SWATLDRLFA  300
YQLNGQTETS RQLPCFPIDP AMAYCIPNDL QLPTLRSSFP LPSNRSYHGA QDYNNEIDLW  360
NFTTRSSSDT LCHLSDTGA*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3ulx_A2e-4891749169Stress-induced transcription factor NAC1
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAB5999400.0AB599940.1 Populus trichocarpa PtVNS09 mRNA for transcription factor, complete cds.
GenBankHQ2158490.0HQ215849.1 Populus trichocarpa wood-associated NAC domain transcription factor 2A (WND2A) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002320897.20.0no apical meristem family protein
SwissprotQ84WP61e-136NAC43_ARATH; NAC domain-containing protein 43
TrEMBLE5KUH30.0E5KUH3_POPTR; No apical meristem family protein
STRINGPOPTR_0014s10060.10.0(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF30313374
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G46770.11e-137NAC family protein